BCAP31 Blocking Peptide (33R-8871)
A synthetic peptide for use as a blocking control in assays to test for specificity of BCAP31 antibody, catalog no. 70R-6009
Overview
Overview
| Synonyms | BCAP31 control peptide, BCAP31 antibody Blocking Peptide, Anti-BCAP31 Blocking Peptide, B-Cell Receptor-Associated Protein 31 Blocking Peptide, 6C6-AG Blocking Peptide, BAP31 Blocking Peptide, CDM Blocking Peptide, DXS1357E Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | STKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE |
|---|---|
| Molecular Weight | 28 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | BCAP31 is a member of the B-cell receptor associated protein 31 superfamily. It is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in the caspase 8-mediated apoptosis. Microdeletions in this gene are associated with the contiguous ABCD1/DXS1375E deletion syndrome. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product