BCAP31 Blocking Peptide (33R-8871)

A synthetic peptide for use as a blocking control in assays to test for specificity of BCAP31 antibody, catalog no. 70R-6009

Synonyms BCAP31 control peptide, BCAP31 antibody Blocking Peptide, Anti-BCAP31 Blocking Peptide, B-Cell Receptor-Associated Protein 31 Blocking Peptide, 6C6-AG Blocking Peptide, BAP31 Blocking Peptide, CDM Blocking Peptide, DXS1357E Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues STKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE
Molecular Weight 28 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BCAP31 is a member of the B-cell receptor associated protein 31 superfamily. It is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in the caspase 8-mediated apoptosis. Microdeletions in this gene are associated with the contiguous ABCD1/DXS1375E deletion syndrome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors