BCAS2 Blocking Peptide (33R-8559)

A synthetic peptide for use as a blocking control in assays to test for specificity of BCAS2 antibody, catalog no. 70R-4719

Synonyms BCAS2 control peptide, BCAS2 antibody Blocking Peptide, Anti-BCAS2 Blocking Peptide, Breast Carcinoma Amplified Sequence 2 Blocking Peptide, DAM1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
Molecular Weight 26 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BCAS2 belongs to the SPF27 family. It is involved in mRNA splicing. The protein might play an important role in breast cancer development by increasing the estrogen receptor's function.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors