BCAS2 Blocking Peptide (33R-8559)
A synthetic peptide for use as a blocking control in assays to test for specificity of BCAS2 antibody, catalog no. 70R-4719
Overview
Overview
| Synonyms | BCAS2 control peptide, BCAS2 antibody Blocking Peptide, Anti-BCAS2 Blocking Peptide, Breast Carcinoma Amplified Sequence 2 Blocking Peptide, DAM1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF |
|---|---|
| Molecular Weight | 26 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | BCAS2 belongs to the SPF27 family. It is involved in mRNA splicing. The protein might play an important role in breast cancer development by increasing the estrogen receptor's function. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product