BCKDHA antibody (70R-5330)

Rabbit polyclonal BCKDHA antibody raised against the N terminal of BCKDHA

Synonyms Polyclonal BCKDHA antibody, Anti-BCKDHA antibody, Branched Chain Keto Acid Dehydrogenase E1 Alpha Polypeptide antibody, FLJ45695 antibody, MSU antibody, MSUD1 antibody
Specificity BCKDHA antibody was raised against the N terminal of BCKDHA
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen BCKDHA antibody was raised using the N terminal of BCKDHA corresponding to a region with amino acids NVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILY
Assay Information BCKDHA Blocking Peptide, catalog no. 33R-6914, is also available for use as a blocking control in assays to test for specificity of this BCKDHA antibody


Western Blot analysis using BCKDHA antibody (70R-5330)

BCKDHA antibody (70R-5330) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BCKDHA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO2. It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using BCKDHA antibody (70R-5330) | BCKDHA antibody (70R-5330) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €309.90
Size: 50 ug
View Our Distributors