BFSP1 Blocking Peptide (33R-7771)
A synthetic peptide for use as a blocking control in assays to test for specificity of BFSP1 antibody, catalog no. 70R-4876
Overview
Overview
| Synonyms | BFSP1 control peptide, BFSP1 antibody Blocking Peptide, Anti-BFSP1 Blocking Peptide, Beaded Filament Structural Protein 1 Filensin Blocking Peptide, CP115 Blocking Peptide, CP94 Blocking Peptide, FILENSIN Blocking Peptide, LIFL-H Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QVESNRQRVRDLEAERARLERQGTEAQRALDEFRSKYENECECQLLLKEM |
|---|---|
| Molecular Weight | 74 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | More than 99% of the vertebrate ocular lens is comprised of terminally differentiated lens fiber cells. Two lens-specific intermediate filament-like proteins, CP49 (also known as phakinin) and BFSP1 (or CP115), are expressed only after fiber cell differentiation has begun. Both proteins are found in a structurally unique cytoskeletal element that is referred to as the beaded filament. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product