BFSP1 Blocking Peptide (33R-7771)

A synthetic peptide for use as a blocking control in assays to test for specificity of BFSP1 antibody, catalog no. 70R-4876

Synonyms BFSP1 control peptide, BFSP1 antibody Blocking Peptide, Anti-BFSP1 Blocking Peptide, Beaded Filament Structural Protein 1 Filensin Blocking Peptide, CP115 Blocking Peptide, CP94 Blocking Peptide, FILENSIN Blocking Peptide, LIFL-H Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QVESNRQRVRDLEAERARLERQGTEAQRALDEFRSKYENECECQLLLKEM
Molecular Weight 74 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance More than 99% of the vertebrate ocular lens is comprised of terminally differentiated lens fiber cells. Two lens-specific intermediate filament-like proteins, CP49 (also known as phakinin) and BFSP1 (or CP115), are expressed only after fiber cell differentiation has begun. Both proteins are found in a structurally unique cytoskeletal element that is referred to as the beaded filament.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors