BLK antibody (70R-1644)

Rabbit polyclonal BLK antibody raised against the middle region of BLK

Synonyms Polyclonal BLK antibody, Anti-BLK antibody, B Lymphoid Tyrosine Kinase antibody, MGC10442 antibody
Specificity BLK antibody was raised against the middle region of BLK
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen BLK antibody was raised using the middle region of BLK corresponding to a region with amino acids AVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAY
Assay Information BLK Blocking Peptide, catalog no. 33R-1621, is also available for use as a blocking control in assays to test for specificity of this BLK antibody


Western Blot analysis using BLK antibody (70R-1644)

BLK antibody (70R-1644) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of BLK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BLK may function in a signal transduction pathway that is restricted to B-lymphoid cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using BLK antibody (70R-1644) | BLK antibody (70R-1644) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors