BLNK antibody (70R-5736)

Rabbit polyclonal BLNK antibody raised against the middle region of BLNK

Synonyms Polyclonal BLNK antibody, Anti-BLNK antibody, MGC111051 antibody, SLP65 antibody, SLP-65 antibody, BASH antibody, Ly57 antibody, BLNK-s antibody, B-Cell Linker antibody
Specificity BLNK antibody was raised against the middle region of BLNK
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen BLNK antibody was raised using the middle region of BLNK corresponding to a region with amino acids QYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKV
Assay Information BLNK Blocking Peptide, catalog no. 33R-7788, is also available for use as a blocking control in assays to test for specificity of this BLNK antibody

Images

Western Blot analysis using BLNK antibody (70R-5736)

BLNK antibody (70R-5736) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BLNK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a cytoplasmic linker or adaptor protein that plays a critical role in B cell development. This protein bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using BLNK antibody (70R-5736) | BLNK antibody (70R-5736) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors