BLNK Blocking Peptide (33R-7788)

A synthetic peptide for use as a blocking control in assays to test for specificity of BLNK antibody, catalog no. 70R-5736

Synonyms BLNK control peptide, BLNK antibody Blocking Peptide, Anti-BLNK Blocking Peptide, B-Cell Linker Blocking Peptide, BASH Blocking Peptide, BLNK-s Blocking Peptide, Ly57 Blocking Peptide, MGC111051 Blocking Peptide, SLP-65 Blocking Peptide, SLP65 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKV
Molecular Weight 50 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a cytoplasmic linker or adaptor protein that plays a critical role in B cell development. This protein bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors