BLNK Blocking Peptide (33R-7788)
A synthetic peptide for use as a blocking control in assays to test for specificity of BLNK antibody, catalog no. 70R-5736
Overview
Overview
| Synonyms | BLNK control peptide, BLNK antibody Blocking Peptide, Anti-BLNK Blocking Peptide, B-Cell Linker Blocking Peptide, BASH Blocking Peptide, BLNK-s Blocking Peptide, Ly57 Blocking Peptide, MGC111051 Blocking Peptide, SLP-65 Blocking Peptide, SLP65 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKV |
|---|---|
| Molecular Weight | 50 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene encodes a cytoplasmic linker or adaptor protein that plays a critical role in B cell development. This protein bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product