BLVRB antibody (70R-2179)

Rabbit polyclonal BLVRB antibody raised against the middle region of BLVRB

Synonyms Polyclonal BLVRB antibody, Anti-BLVRB antibody, Flavin Reductase antibody, Biliverdin Reductase B antibody, BVRB antibody, MGC117413 antibody, Flavin Reductase antibody, FLR antibody
Specificity BLVRB antibody was raised against the middle region of BLVRB
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen BLVRB antibody was raised using the middle region of BLVRB corresponding to a region with amino acids GLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTD
Assay Information BLVRB Blocking Peptide, catalog no. 33R-3403, is also available for use as a blocking control in assays to test for specificity of this BLVRB antibody

Images

Western Blot analysis using BLVRB antibody (70R-2179)

BLVRB antibody (70R-2179) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BLVRB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BLVRB catalyzes electron transfer from reduced pyridine nucleotides to flavins as well as methylene blue, pyrroloquinoline quinone, riboflavin, or methemoglobin. BLVRB has possible role in protecting cells from oxidative damage or in regulating iron metabolism. In the liver, BLVRB converts biliverdin to bilirubin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using BLVRB antibody (70R-2179) | BLVRB antibody (70R-2179) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors