BMP2K antibody (70R-1033)

Rabbit polyclonal BMP2K antibody raised against the C terminal of BMP2K

Synonyms Polyclonal BMP2K antibody, Anti-BMP2K antibody, DKFZp434K0614 antibody, BMPK-2 antibody, BMP2K, DKFZp434P0116 antibody, Bmp2 Inducible Kinase antibody, BMPK 2, BMPK 2 antibody, BIKE antibody, BMPK-2, HRIHFB2017 antibody
Specificity BMP2K antibody was raised against the C terminal of BMP2K
Cross Reactivity Human,Dog
Applications IHC, WB
Immunogen BMP2K antibody was raised using the C terminal of BMP2K corresponding to a region with amino acids AQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSV
Assay Information BMP2K Blocking Peptide, catalog no. 33R-1448, is also available for use as a blocking control in assays to test for specificity of this BMP2K antibody


Immunohistochemical staining using BMP2K antibody (70R-1033)

BMP2K antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 74 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of BMP2K antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BMP2K is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. BMP2K is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. This gene is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using BMP2K antibody (70R-1033) | BMP2K antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using BMP2K antibody (70R-1033) | BMP2K antibody (70R-1033) used at 5 ug/ml to detect target protein.
  • Immunohistochemical staining using BMP2K antibody (70R-1033) | BMP2K antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors