BMPER antibody (70R-5473)

Rabbit polyclonal BMPER antibody raised against the C terminal of BMPER

Synonyms Polyclonal BMPER antibody, Anti-BMPER antibody, Bmp Binding Endothelial Regulator antibody, CRIM3 antibody, CV-2 antibody, CV2 antibody
Specificity BMPER antibody was raised against the C terminal of BMPER
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen BMPER antibody was raised using the C terminal of BMPER corresponding to a region with amino acids NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV
Assay Information BMPER Blocking Peptide, catalog no. 33R-6702, is also available for use as a blocking control in assays to test for specificity of this BMPER antibody

Images

Immunohistochemical staining using BMPER antibody (70R-5473)

BMPER antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 76 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BMPER antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BMPER contains 1 TIL (trypsin inhibitory-like) domain, 5 VWFC domains and 1 VWFD domain.BMPER is the inhibitor of bone morphogenetic protein (BMP) functions. It may regulate BMP responsiveness of osteoblasts and chondrocytes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using BMPER antibody (70R-5473) | BMPER antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using BMPER antibody (70R-5473) | BMPER antibody (70R-5473) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €309.90
Size: 50 ug
OR
Shipping
View Our Distributors