BMPER Blocking Peptide (33R-6702)
A synthetic peptide for use as a blocking control in assays to test for specificity of BMPER antibody, catalog no. 70R-5473
Overview
Overview
| Synonyms | BMPER control peptide, BMPER antibody Blocking Peptide, Anti-BMPER Blocking Peptide, Bmp Binding Endothelial Regulator Blocking Peptide, CRIM3 Blocking Peptide, CV-2 Blocking Peptide, CV2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV |
|---|---|
| Molecular Weight | 76 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | BMPER contains 1 TIL (trypsin inhibitory-like) domain, 5 VWFC domains and 1 VWFD domain.BMPER is the inhibitor of bone morphogenetic protein (BMP) functions. It may regulate BMP responsiveness of osteoblasts and chondrocytes. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product