BMPER Blocking Peptide (33R-6702)

A synthetic peptide for use as a blocking control in assays to test for specificity of BMPER antibody, catalog no. 70R-5473

Synonyms BMPER control peptide, BMPER antibody Blocking Peptide, Anti-BMPER Blocking Peptide, Bmp Binding Endothelial Regulator Blocking Peptide, CRIM3 Blocking Peptide, CV-2 Blocking Peptide, CV2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV
Molecular Weight 76 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BMPER contains 1 TIL (trypsin inhibitory-like) domain, 5 VWFC domains and 1 VWFD domain.BMPER is the inhibitor of bone morphogenetic protein (BMP) functions. It may regulate BMP responsiveness of osteoblasts and chondrocytes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors