BNIP1 Blocking Peptide (33R-7730)
A synthetic peptide for use as a blocking control in assays to test for specificity of BNIP1 antibody, catalog no. 70R-9800
Overview
Overview
| Synonyms | BNIP1 control peptide, BNIP1 antibody Blocking Peptide, Anti-BNIP1 Blocking Peptide, BCL2/adenovirus E1B 19kDa interacting protein 1 Blocking Peptide, NIP1 Blocking Peptide, SEC20 Blocking Peptide, TRG-8 Blocking Peptide, BNIP1, BNIP-1, BNIP 1, BNIP-1 Blocking Peptide, BNIP 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALA |
|---|---|
| Molecular Weight | 26 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19 kDa-like sequences of BCL2, also an apoptotic protector. Alternative splicing of this gene results in four protein products with identical N- and C-termini. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product