BNIP1 Blocking Peptide (33R-7730)

A synthetic peptide for use as a blocking control in assays to test for specificity of BNIP1 antibody, catalog no. 70R-9800

Synonyms BNIP1 control peptide, BNIP1 antibody Blocking Peptide, Anti-BNIP1 Blocking Peptide, BCL2/adenovirus E1B 19kDa interacting protein 1 Blocking Peptide, NIP1 Blocking Peptide, SEC20 Blocking Peptide, TRG-8 Blocking Peptide, BNIP1, BNIP-1, BNIP 1, BNIP-1 Blocking Peptide, BNIP 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALA
Molecular Weight 26 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19 kDa-like sequences of BCL2, also an apoptotic protector. Alternative splicing of this gene results in four protein products with identical N- and C-termini.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors