Bradykinin Receptor B2 antibody (70R-1662)

Rabbit polyclonal Bradykinin Receptor B2 antibody raised against the N terminal of BDKRB2

Synonyms Polyclonal Bradykinin Receptor B2 antibody, Anti-Bradykinin Receptor B2 antibody, BK2 antibody, BKNRB2 antibody, BKR2 antibody, BRB2 antibody, DKFZp686O088 antibody, B2R antibody, BK-2 antibody
Specificity Bradykinin Receptor B2 antibody was raised against the N terminal of BDKRB2
Cross Reactivity Human
Applications WB
Immunogen Bradykinin Receptor B2 antibody was raised using the N terminal of BDKRB2 corresponding to a region with amino acids MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQV
Assay Information Bradykinin Receptor B2 Blocking Peptide, catalog no. 33R-6004, is also available for use as a blocking control in assays to test for specificity of this Bradykinin Receptor B2 antibody

Images

Western Blot analysis using Bradykinin Receptor B2 antibody (70R-1662)

Bradykinin Receptor B2 antibody (70R-1662) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BDKRB2 is a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Bradykinin Receptor B2 antibody (70R-1662) | Bradykinin Receptor B2 antibody (70R-1662) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €262.58
Size: 100 ug
OR
Shipping
View Our Distributors