Bradykinin Receptor B2 antibody (70R-1662)
Rabbit polyclonal Bradykinin Receptor B2 antibody raised against the N terminal of BDKRB2
Overview
Overview
| Synonyms | Polyclonal Bradykinin Receptor B2 antibody, Anti-Bradykinin Receptor B2 antibody, BK2 antibody, BKNRB2 antibody, BKR2 antibody, BRB2 antibody, DKFZp686O088 antibody, B2R antibody, BK-2 antibody |
|---|---|
| Specificity | Bradykinin Receptor B2 antibody was raised against the N terminal of BDKRB2 |
| Cross Reactivity | Human |
| Applications | WB |
| Immunogen | Bradykinin Receptor B2 antibody was raised using the N terminal of BDKRB2 corresponding to a region with amino acids MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQV |
| Assay Information | Bradykinin Receptor B2 Blocking Peptide, catalog no. 33R-6004, is also available for use as a blocking control in assays to test for specificity of this Bradykinin Receptor B2 antibody |
Images
Western Blot analysis using Bradykinin Receptor B2 antibody (70R-1662)
Bradykinin Receptor B2 antibody (70R-1662) used at 5 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Total IgG Protein A purified |
| Molecular Weight | 43 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 5 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | BDKRB2 is a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product