BRAP antibody (70R-2571)

Rabbit polyclonal BRAP antibody raised against the middle region of BRAP

Synonyms Polyclonal BRAP antibody, Anti-BRAP antibody, IMP antibody, RNF52 antibody, BRAP2 antibody, Brca1 Associated Protein antibody
Specificity BRAP antibody was raised against the middle region of BRAP
Cross Reactivity Human
Applications WB
Immunogen BRAP antibody was raised using the middle region of BRAP corresponding to a region with amino acids YLETQQKINHLPAETRQEIQEGQINIAMASASSPASSGGSGKLPSRKGRS
Assay Information BRAP Blocking Peptide, catalog no. 33R-10166, is also available for use as a blocking control in assays to test for specificity of this BRAP antibody


Western Blot analysis using BRAP antibody (70R-2571)

BRAP antibody (70R-2571) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BRAP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene was identified by its ability to bind to the nuclear localization signal of BRCA1 and other proteins. It is a cytoplasmic protein which may regulate nuclear targeting by retaining proteins with a nuclear localization signal in the cytoplasm.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using BRAP antibody (70R-2571) | BRAP antibody (70R-2571) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors