BRWD1 antibody (70R-2548)
Rabbit polyclonal BRWD1 antibody raised against the N terminal of BRWD1
Overview
Overview
Synonyms | Polyclonal BRWD1 antibody, Anti-BRWD1 antibody, C21orf107 antibody, FLJ43918 antibody, Bromodomain And Wd Repeat Domain Containing 1 antibody, WDR9 antibody, N143 antibody |
---|---|
Specificity | BRWD1 antibody was raised against the N terminal of BRWD1 |
Cross Reactivity | Human |
Applications | WB |
Immunogen | BRWD1 antibody was raised using the N terminal of BRWD1 corresponding to a region with amino acids MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPK |
Assay Information | BRWD1 Blocking Peptide, catalog no. 33R-5643, is also available for use as a blocking control in assays to test for specificity of this BRWD1 antibody |
Images
Western Blot analysis using BRWD1 antibody (70R-2548)
BRWD1 antibody (70R-2548) used at 1 ug/ml to detect target protein.
Specifications
Host | Rabbit |
---|---|
Method of Purification | Affinity purified |
Molecular Weight | 13 kDa (MW of target protein) |
Form & Buffer | Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BRWD1 antibody in PBS |
Concentration | 1 mg/ml |
Usage & Assay Information
Usage Recommendations | WB: 1 ug/ml |
---|
Storage & Safety
Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
---|
General Information
Biological Significance | This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com |
---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product