BSDC1 antibody (70R-1153)

Rabbit polyclonal BSDC1 antibody raised against the N terminal of BSDC1

Synonyms Polyclonal BSDC1 antibody, Anti-BSDC1 antibody, RP4-811H24.7 antibody, DKFZp686B09139 antibody, FLJ10276 antibody, Bsd Domain Containing 1 antibody
Specificity BSDC1 antibody was raised against the N terminal of BSDC1
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications IHC, WB
Immunogen BSDC1 antibody was raised using the N terminal of BSDC1 corresponding to a region with amino acids VISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKARLYSLQSDPATYC
Assay Information BSDC1 Blocking Peptide, catalog no. 33R-9610, is also available for use as a blocking control in assays to test for specificity of this BSDC1 antibody


Immunohistochemical staining using BSDC1 antibody (70R-1153)

BSDC1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of BSDC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BSDC1 may be involved in protein binding.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using BSDC1 antibody (70R-1153) | BSDC1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using BSDC1 antibody (70R-1153) | BSDC1 antibody (70R-1153) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors