BUB3 antibody (70R-5623)

Rabbit polyclonal BUB3 antibody

Synonyms Polyclonal BUB3 antibody, Anti-BUB3 antibody, BUB3L antibody, hBUB3 antibody, Bub3 Budding Uninhibited By Benzimidazoles 3 Homolog antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen BUB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMR
Assay Information BUB3 Blocking Peptide, catalog no. 33R-6544, is also available for use as a blocking control in assays to test for specificity of this BUB3 antibody


Western Blot analysis using BUB3 antibody (70R-5623)

BUB3 antibody (70R-5623) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BUB3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BUB3 is required for kinetochore localization of BUB1.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using BUB3 antibody (70R-5623) | BUB3 antibody (70R-5623) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors