IRX3 Blocking Peptide (33R-1003)
A synthetic peptide for use as a blocking control in assays to test for specificity of BXDC5 antibody, catalog no. 70R-4968
Overview
Overview
| Synonyms | BXDC5 control peptide, BXDC5 antibody Blocking Peptide, Anti-BXDC5 Blocking Peptide, Brix Domain Containing 5 Blocking Peptide, DKFZp761G0415 Blocking Peptide, DKFZp761M0215 Blocking Peptide, FLJ12475 Blocking Peptide, RP11-118B23.1 Blocking Peptide, RPF1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAAFPPGFSISEIKNKQRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGD |
|---|---|
| Molecular Weight | 38 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | BXDC5 may be required for ribosome biogenesis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product