IRX3 Blocking Peptide (33R-1003)

A synthetic peptide for use as a blocking control in assays to test for specificity of BXDC5 antibody, catalog no. 70R-4968

Synonyms BXDC5 control peptide, BXDC5 antibody Blocking Peptide, Anti-BXDC5 Blocking Peptide, Brix Domain Containing 5 Blocking Peptide, DKFZp761G0415 Blocking Peptide, DKFZp761M0215 Blocking Peptide, FLJ12475 Blocking Peptide, RP11-118B23.1 Blocking Peptide, RPF1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAAFPPGFSISEIKNKQRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGD
Molecular Weight 38 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BXDC5 may be required for ribosome biogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €113.70
Size: 100 ug
OR
Shipping
View Our Distributors