C10ORF33 antibody (70R-3261)

Rabbit polyclonal C10ORF33 antibody raised against the N terminal Of C10Orf33

Synonyms Polyclonal C10ORF33 antibody, Anti-C10ORF33 antibody, Chromosome ORF 10 antibody, Chromosome 10 ORF, MGC13047 antibody, Chromosome ORF 10, Chromosome ORF-10, Chromosome ORF-10 antibody, FLJ23849 antibody
Specificity C10ORF33 antibody was raised against the N terminal Of C10Orf33
Cross Reactivity Human
Applications WB
Immunogen C10ORF33 antibody was raised using the N terminal Of C10Orf33 corresponding to a region with amino acids MAASGRGLCKAVAASPFPAWRRDNTEARGGLKPEYDAVVIGAGHNGLVAA
Assay Information C10ORF33 Blocking Peptide, catalog no. 33R-5610, is also available for use as a blocking control in assays to test for specificity of this C10ORF33 antibody


Western Blot analysis using C10ORF33 antibody (70R-3261)

C10ORF33 antibody (70R-3261) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C10ORF33 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C10orf33 is probably involved in oxidoreductase activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C10ORF33 antibody (70R-3261) | C10ORF33 antibody (70R-3261) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors