C11ORF46 antibody (70R-3419)

Rabbit polyclonal C11ORF46 antibody raised against the N terminal Of C11Orf46

Synonyms Polyclonal C11ORF46 antibody, Anti-C11ORF46 antibody, Chromosome ORF-11, Chromosome ORF 11, FLJ38968 antibody, dJ299F11.1 antibody, Chromosome ORF 11 antibody, Chromosome ORF-11 antibody, Chromosome 11 ORF
Specificity C11ORF46 antibody was raised against the N terminal Of C11Orf46
Cross Reactivity Human,Mouse
Applications WB
Immunogen C11ORF46 antibody was raised using the N terminal Of C11Orf46 corresponding to a region with amino acids SSNDMLLLQLRTGMTLSGNNTICFHHVKIYIDRFEDLQKSCCDPFNIHKK
Assay Information C11ORF46 Blocking Peptide, catalog no. 33R-8831, is also available for use as a blocking control in assays to test for specificity of this C11ORF46 antibody

Images

Western Blot analysis using C11ORF46 antibody (70R-3419)

C11ORF46 antibody (70R-3419) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C11ORF46 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 11 ORF protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C11ORF46 antibody (70R-3419) | C11ORF46 antibody (70R-3419) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors