C11ORF67 antibody (70R-4245)

Rabbit polyclonal C11ORF67 antibody raised against the middle region of C11Orf67

Synonyms Polyclonal C11ORF67 antibody, Anti-C11ORF67 antibody, MGC3367 antibody, Chromosome ORF 11, PTD015 antibody, Chromosome ORF 11 antibody, Chromosome 11 ORF, Chromosome ORF-11, Chromosome ORF-11 antibody, FLJ21035 antibody
Specificity C11ORF67 antibody was raised against the middle region of C11Orf67
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C11ORF67 antibody was raised using the middle region of C11Orf67 corresponding to a region with amino acids SEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHST
Assay Information C11ORF67 Blocking Peptide, catalog no. 33R-8383, is also available for use as a blocking control in assays to test for specificity of this C11ORF67 antibody

Images

Western Blot analysis using C11ORF67 antibody (70R-4245)

C11ORF67 antibody (70R-4245) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 13 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C11ORF67 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C11orf67 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C11ORF67 antibody (70R-4245) | C11ORF67 antibody (70R-4245) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors