C11orf73 antibody (70R-4038)

Rabbit polyclonal C11orf73 antibody raised against the middle region of C11orf73

Synonyms Polyclonal C11orf73 antibody, Anti-C11orf73 antibody, Chromosome 11 Open Reading Frame 73 antibody, HSPC138 antibody, Chromosome ORF 11 antibody, Chromosome 11 ORF, Chromosome ORF-11 antibody, Chromosome ORF 11, Chromosome ORF-11, L7RN6 antibody, HSPC179 antibody
Specificity C11orf73 antibody was raised against the middle region of C11orf73
Cross Reactivity Human
Applications WB
Immunogen C11orf73 antibody was raised using the middle region of C11orf73 corresponding to a region with amino acids DNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK
Assay Information C11orf73 Blocking Peptide, catalog no. 33R-2080, is also available for use as a blocking control in assays to test for specificity of this C11orf73 antibody


Western Blot analysis using C11orf73 antibody (70R-4038)

C11orf73 antibody (70R-4038) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C11orf73 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The C11orf73 protein is required for the organization and/or function of the secretory apparatus in Clara cells in the lung.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C11orf73 antibody (70R-4038) | C11orf73 antibody (70R-4038) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors