C12ORF11 antibody (70R-4092)

Rabbit polyclonal C12ORF11 antibody raised against the middle region of C12Orf11

Synonyms Polyclonal C12ORF11 antibody, Anti-C12ORF11 antibody, Chromosome 12 ORF, FLJ10637 antibody, FLJ10630 antibody, Chromosome ORF-12 antibody, Chromosome ORF 12, Chromosome ORF-12, Chromosome ORF 12 antibody
Specificity C12ORF11 antibody was raised against the middle region of C12Orf11
Cross Reactivity Human
Applications WB
Immunogen C12ORF11 antibody was raised using the middle region of C12Orf11 corresponding to a region with amino acids VQQHFDLASTTITNIPMKEEQHANTSANYDVELLHHKDAHVDFLKSGDSH
Assay Information C12ORF11 Blocking Peptide, catalog no. 33R-9756, is also available for use as a blocking control in assays to test for specificity of this C12ORF11 antibody


Western Blot analysis using C12ORF11 antibody (70R-4092)

C12ORF11 antibody (70R-4092) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 80 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C12ORF11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C12ORF11 is a crucial regulator of the mitotic cell cycle and development.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C12ORF11 antibody (70R-4092) | C12ORF11 antibody (70R-4092) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors