C12ORF4 Blocking Peptide (33R-7530)

A synthetic peptide for use as a blocking control in assays to test for specificity of C12orf4 antibody, catalog no. 70R-3498

Synonyms C12ORF4 control peptide, C12ORF4 antibody Blocking Peptide, Anti-C12ORF4 Blocking Peptide, FLJ21158 Blocking Peptide, FLJ23899 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QELGKSLTDQDVNSLAAQHFESQQDLENKWSNELKQSTAIQKQEYQEWVI
Molecular Weight 64 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 12 ORF protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors