C13orf30 antibody (70R-4041)

Rabbit polyclonal C13orf30 antibody raised against the N terminal of C13orf30

Synonyms Polyclonal C13orf30 antibody, Anti-C13orf30 antibody, Chromosome ORF-13, Chromosome ORF 13, Chromosome ORF 13 antibody, FLJ40919 antibody, MGC138442 antibody, Chromosome ORF-13 antibody, Chromosome 13 ORF, Chromosome 13 Open Reading Frame 30 antibody
Specificity C13orf30 antibody was raised against the N terminal of C13orf30
Cross Reactivity Human
Applications WB
Immunogen C13orf30 antibody was raised using the N terminal of C13orf30 corresponding to a region with amino acids MGQNWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIY
Assay Information C13orf30 Blocking Peptide, catalog no. 33R-6063, is also available for use as a blocking control in assays to test for specificity of this C13orf30 antibody


Western Blot analysis using C13orf30 antibody (70R-4041)

C13orf30 antibody (70R-4041) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C13orf30 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 13 ORF protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C13orf30 antibody (70R-4041) | C13orf30 antibody (70R-4041) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors