C14ORF104 antibody (70R-4364)

Rabbit polyclonal C14ORF104 antibody raised against the N terminal Of C14Orf104

Synonyms Polyclonal C14ORF104 antibody, Anti-C14ORF104 antibody, Chromosome ORF-14 antibody, Chromosome ORF 14 antibody, Chromosome ORF 14, FLJ10563 antibody, Chromosome 14 ORF, Chromosome ORF-14
Specificity C14ORF104 antibody was raised against the N terminal Of C14Orf104
Cross Reactivity Human
Applications WB
Immunogen C14ORF104 antibody was raised using the N terminal Of C14Orf104 corresponding to a region with amino acids MFSQYAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRTSLDG
Assay Information C14ORF104 Blocking Peptide, catalog no. 33R-6005, is also available for use as a blocking control in assays to test for specificity of this C14ORF104 antibody

Images

Western Blot analysis using C14ORF104 antibody (70R-4364)

C14ORF104 antibody (70R-4364) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 91 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C14ORF104 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This protein is highly conserved and involved in the preassembly of dynein arm complexes which power cilia. These complexes are found in some cilia and are assembled in the cytoplasm prior to transport for cilia formation. Mutations in this gene have been associated with primary ciliary dyskinesia. Multiple transcript variants encoding different isoforms have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C14ORF104 antibody (70R-4364) | C14ORF104 antibody (70R-4364) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors