C14ORF80 antibody (70R-4260)

Rabbit polyclonal C14ORF80 antibody raised against the N terminal Of C14Orf80

Synonyms Polyclonal C14ORF80 antibody, Anti-C14ORF80 antibody, Chromosome ORF-14 antibody, Chromosome 14 ORF, Chromosome ORF-14, Chromosome ORF 14 antibody, Chromosome ORF 14
Specificity C14ORF80 antibody was raised against the N terminal Of C14Orf80
Cross Reactivity Human
Applications WB
Immunogen C14ORF80 antibody was raised using the N terminal Of C14Orf80 corresponding to a region with amino acids MLAQARVPLGDEMTVCQIHLYTRGCHSDQSLSHLSVTEAEMLRDPEGGQQ
Assay Information C14ORF80 Blocking Peptide, catalog no. 33R-6179, is also available for use as a blocking control in assays to test for specificity of this C14ORF80 antibody


Western Blot analysis using C14ORF80 antibody (70R-4260)

C14ORF80 antibody (70R-4260) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C14ORF80 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of C14orf80 is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C14ORF80 antibody (70R-4260) | C14ORF80 antibody (70R-4260) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors