C15ORF15 antibody (70R-3222)

Rabbit polyclonal C15ORF15 antibody raised against the middle region of C15Orf15

Synonyms Polyclonal C15ORF15 antibody, Anti-C15ORF15 antibody, RPL24L antibody, Chromosome 15 ORF, L30 antibody, HRP-L30-iso antibody, RPL24 antibody, Chromosome ORF 15, RLP24 antibody, Chromosome ORF-15 antibody, Chromosome ORF 15 antibody, Chromosome ORF-15
Specificity C15ORF15 antibody was raised against the middle region of C15Orf15
Cross Reactivity Human
Applications WB
Immunogen C15ORF15 antibody was raised using the middle region of C15Orf15 corresponding to a region with amino acids KCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQRE
Assay Information C15ORF15 Blocking Peptide, catalog no. 33R-4271, is also available for use as a blocking control in assays to test for specificity of this C15ORF15 antibody


Western Blot analysis using C15ORF15 antibody (70R-3222)

C15ORF15 antibody (70R-3222) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C15ORF15 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a protein sharing a low level of sequence similarity with human ribosomal protein L24. Although this gene has been referred to as RPL24, L30, and 60S ribosomal protein L30 isolog in the sequence databases, it is distinct from the human genes officially named RPL24 (which itself has been referred to as ribosomal protein L30) and RPL30. The function of this gene is currently unknown. This gene utilizes alternative polyadenylation signals.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C15ORF15 antibody (70R-3222) | C15ORF15 antibody (70R-3222) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors