C15ORF27 antibody (70R-1953)

Rabbit polyclonal C15ORF27 antibody

Synonyms Polyclonal C15ORF27 antibody, Anti-C15ORF27 antibody, Chromosome ORF 15, Chromosome 15 ORF, Chromosome ORF-15 antibody, Chromosome ORF-15, Chromosome ORF 15 antibody, FLJ38190 antibody, FLJ30304 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C15ORF27 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMEMVIQQYEKAKVIQDEQLERLTQICQEQGFEIRQLRAHLAQQDLDLAA
Assay Information C15ORF27 Blocking Peptide, catalog no. 33R-2583, is also available for use as a blocking control in assays to test for specificity of this C15ORF27 antibody


Western Blot analysis using C15ORF27 antibody (70R-1953)

C15ORF27 antibody (70R-1953) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C15ORF27 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C15orf27 is a multi-pass membrane protein. The exact function of C15orf27 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C15ORF27 antibody (70R-1953) | C15ORF27 antibody (70R-1953) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors