C16ORF58 Blocking Peptide (33R-7482)
A synthetic peptide for use as a blocking control in assays to test for specificity of C16orf58 antibody, catalog no. 70R-6452
Overview
Overview
| Synonyms | C16ORF58 control peptide, C16ORF58 antibody Blocking Peptide, Anti-C16ORF58 Blocking Peptide, FLJ13868 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QAVFLPQGFPDSVSPDYLPYQLWDSVQAFASSLSGSLATQAVLLGIGVGN |
|---|---|
| Molecular Weight | 51 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The function of C16orf58 protein has not been widely studied, and is yet to be fully elucidated. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product