C16ORF71 antibody (70R-3221)

Rabbit polyclonal C16ORF71 antibody raised against the middle region of C16Orf71

Synonyms Polyclonal C16ORF71 antibody, Anti-C16ORF71 antibody, Chromosome ORF 16 antibody, DKFZp686H2240 antibody, FLJ43261 antibody, Chromosome ORF-16 antibody, Chromosome 16 ORF, Chromosome ORF-16, Chromosome ORF 16
Specificity C16ORF71 antibody was raised against the middle region of C16Orf71
Cross Reactivity Human
Applications WB
Immunogen C16ORF71 antibody was raised using the middle region of C16Orf71 corresponding to a region with amino acids KASACARKVPADTPQDTKEADSGSRCASRKQGSQAGPGPQLAQGMRLNAE
Assay Information C16ORF71 Blocking Peptide, catalog no. 33R-4260, is also available for use as a blocking control in assays to test for specificity of this C16ORF71 antibody


Western Blot analysis using C16ORF71 antibody (70R-3221)

C16ORF71 antibody (70R-3221) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C16ORF71 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C16orf71 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C16ORF71 antibody (70R-3221) | C16ORF71 antibody (70R-3221) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors