C16orf73 antibody (70R-4561)

Rabbit polyclonal C16orf73 antibody raised against the middle region of C16orf73

Synonyms Polyclonal C16orf73 antibody, Anti-C16orf73 antibody, gs129 antibody, MGC35212 antibody, Chromosome ORF 16, Chromosome ORF-16 antibody, Chromosome ORF 16 antibody, Chromosome ORF-16, Chromosome 16 Open Reading Frame 73 antibody, Chromosome 16 ORF
Specificity C16orf73 antibody was raised against the middle region of C16orf73
Cross Reactivity Human
Applications WB
Immunogen C16orf73 antibody was raised using the middle region of C16orf73 corresponding to a region with amino acids CSLTGSVAEETLGCTFVLSHRARSGLKISVLSCKLADPTEASRNLSGQKH
Assay Information C16orf73 Blocking Peptide, catalog no. 33R-1811, is also available for use as a blocking control in assays to test for specificity of this C16orf73 antibody


Western Blot analysis using C16orf73 antibody (70R-4561)

C16orf73 antibody (70R-4561) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C16orf73 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C16orf73 may be involved in early meiosis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C16orf73 antibody (70R-4561) | C16orf73 antibody (70R-4561) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors