C17ORF57 antibody (70R-3643)

Rabbit polyclonal C17ORF57 antibody raised against the N terminal Of C17Orf57

Synonyms Polyclonal C17ORF57 antibody, Anti-C17ORF57 antibody, Chromosome ORF 17 antibody, FLJ40342 antibody, Chromosome ORF 17, Chromosome ORF-17, Chromosome ORF-17 antibody, Chromosome 17 ORF
Specificity C17ORF57 antibody was raised against the N terminal Of C17Orf57
Cross Reactivity Human
Applications WB
Immunogen C17ORF57 antibody was raised using the N terminal Of C17Orf57 corresponding to a region with amino acids CGEEKSSDFSGEKKVGRKSLQVQQHSKRTEIIPPFLKLSKEKVTRKENSL
Assay Information C17ORF57 Blocking Peptide, catalog no. 33R-1694, is also available for use as a blocking control in assays to test for specificity of this C17ORF57 antibody

Images

Western Blot analysis using C17ORF57 antibody (70R-3643)

C17ORF57 antibody (70R-3643) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 110 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C17ORF57 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C17orf57 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C17ORF57 antibody (70R-3643) | C17ORF57 antibody (70R-3643) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors