C19ORF54 antibody (70R-3576)

Rabbit polyclonal C19ORF54 antibody raised against the N terminal Of C19Orf54

Synonyms Polyclonal C19ORF54 antibody, Anti-C19ORF54 antibody, Chromosome ORF 19 antibody, Chromosome ORF-19, MGC103014 antibody, Chromosome ORF 19, Chromosome 19 ORF, FLJ41131 antibody, Chromosome ORF-19 antibody
Specificity C19ORF54 antibody was raised against the N terminal Of C19Orf54
Cross Reactivity Human
Applications WB
Immunogen C19ORF54 antibody was raised using the N terminal Of C19Orf54 corresponding to a region with amino acids MTSPCSPPLKPPISPPKTPVPQASSIPSPPLPPSPLDFSALPSPPWSQQT
Assay Information C19ORF54 Blocking Peptide, catalog no. 33R-6564, is also available for use as a blocking control in assays to test for specificity of this C19ORF54 antibody

Images

Western Blot analysis using C19ORF54 antibody (70R-3576)

C19ORF54 antibody (70R-3576) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C19ORF54 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 19 ORF protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C19ORF54 antibody (70R-3576) | C19ORF54 antibody (70R-3576) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors