C19ORF62 antibody (70R-4229)

Rabbit polyclonal C19ORF62 antibody raised against the N terminal Of C19Orf62

Synonyms Polyclonal C19ORF62 antibody, Anti-C19ORF62 antibody, HSPC142 antibody, FLJ20571 antibody, Chromosome ORF 19, Chromosome 19 ORF, Chromosome ORF-19 antibody, Chromosome ORF-19, Chromosome ORF 19 antibody
Specificity C19ORF62 antibody was raised against the N terminal Of C19Orf62
Cross Reactivity Human
Applications WB
Immunogen C19ORF62 antibody was raised using the N terminal Of C19Orf62 corresponding to a region with amino acids DRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIR
Assay Information C19ORF62 Blocking Peptide, catalog no. 33R-2140, is also available for use as a blocking control in assays to test for specificity of this C19ORF62 antibody

Images

Western Blot analysis using C19ORF62 antibody (70R-4229)

C19ORF62 antibody (70R-4229) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C19ORF62 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C19orf62 is a component of the BRCA1-A complex, a complex that specifically recognises 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C19ORF62 antibody (70R-4229) | C19ORF62 antibody (70R-4229) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors