C1ORF142 antibody (70R-4385)

Rabbit polyclonal C1ORF142 antibody raised against the middle region of C1Orf142

Synonyms Polyclonal C1ORF142 antibody, Anti-C1ORF142 antibody, SNAP-47 antibody, Chromosome ORF 1, DKFZp686M10160 antibody, Chromosome 1 ORF, Chromosome ORF 1 antibody, FLJ12517 antibody, SVAP1 antibody, Chromosome ORF-1 antibody, Chromosome ORF-1, IMAGE3451454 antibody
Specificity C1ORF142 antibody was raised against the middle region of C1Orf142
Cross Reactivity Human
Applications WB
Immunogen C1ORF142 antibody was raised using the middle region of C1Orf142 corresponding to a region with amino acids TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA
Assay Information C1ORF142 Blocking Peptide, catalog no. 33R-8979, is also available for use as a blocking control in assays to test for specificity of this C1ORF142 antibody


Western Blot analysis using C1ORF142 antibody (70R-4385)

C1ORF142 antibody (70R-4385) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C1ORF142 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The C1ORF142 protein may play a role in intracellular membrane fusion.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C1ORF142 antibody (70R-4385) | C1ORF142 antibody (70R-4385) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors