C1orf144 antibody (70R-4008)

Rabbit polyclonal C1orf144 antibody raised against the N terminal of C1orf144

Synonyms Polyclonal C1orf144 antibody, Anti-C1orf144 antibody, Chromosome 1 ORF, Chromosome ORF-1, Chromosome ORF 1 antibody, Chromosome 1 Open Reading Frame 144 antibody, MGC70432 antibody, DKFZp566C0424 antibody, Chromosome ORF 1, Chromosome ORF-1 antibody
Specificity C1orf144 antibody was raised against the N terminal of C1orf144
Cross Reactivity Human
Applications WB
Immunogen C1orf144 antibody was raised using the N terminal of C1orf144 corresponding to a region with amino acids MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSN
Assay Information C1orf144 Blocking Peptide, catalog no. 33R-6383, is also available for use as a blocking control in assays to test for specificity of this C1orf144 antibody


Western Blot analysis using C1orf144 antibody (70R-4008)

C1orf144 antibody (70R-4008) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C1orf144 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C1orf144 antibody (70R-4008) | C1orf144 antibody (70R-4008) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors