C1ORF184 antibody (70R-2168)

Rabbit polyclonal C1ORF184 antibody raised against the C terminal Of C1Orf184

Synonyms Polyclonal C1ORF184 antibody, Anti-C1ORF184 antibody, Chromosome ORF 1, Chromosome ORF-1 antibody, Chromosome 1 ORF, Chromosome ORF 1 antibody, Chromosome ORF-1
Specificity C1ORF184 antibody was raised against the C terminal Of C1Orf184
Cross Reactivity Human
Applications WB
Immunogen C1ORF184 antibody was raised using the C terminal Of C1Orf184 corresponding to a region with amino acids NVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQDGFPEQCIPV
Assay Information C1ORF184 Blocking Peptide, catalog no. 33R-6909, is also available for use as a blocking control in assays to test for specificity of this C1ORF184 antibody


Western Blot analysis using C1ORF184 antibody (70R-2168)

C1ORF184 antibody (70R-2168) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C1ORF184 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C1orf184 (Alpha-N-methyltransferase) methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of exposed alpha-amino group of Ala, Pro or Ser residue in the [Ala/Pro/Ser]-Pro-Lys motif.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C1ORF184 antibody (70R-2168) | C1ORF184 antibody (70R-2168) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors