C1ORF25 Blocking Peptide (33R-7473)

A synthetic peptide for use as a blocking control in assays to test for specificity of C1ORF25 antibody, catalog no. 70R-7823

Synonyms C1ORF25 control peptide, C1ORF25 antibody Blocking Peptide, Anti-C1ORF25 Blocking Peptide, C1ORF25, CORF25-1, CORF25 1, CORF25-1 Blocking Peptide, CORF25 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QAPALSPSLASAPEEAKSKRHISIQRQLADLENLAFVTDGNFDSASSLNS
Molecular Weight 61 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Although C1orf25 is similar to N2-dimethylguanosine tRNA methyltransferase from other organisms, the true function of C1orf25 protein is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors