C1ORF25 Blocking Peptide (33R-7473)
A synthetic peptide for use as a blocking control in assays to test for specificity of C1ORF25 antibody, catalog no. 70R-7823
Overview
Overview
| Synonyms | C1ORF25 control peptide, C1ORF25 antibody Blocking Peptide, Anti-C1ORF25 Blocking Peptide, C1ORF25, CORF25-1, CORF25 1, CORF25-1 Blocking Peptide, CORF25 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QAPALSPSLASAPEEAKSKRHISIQRQLADLENLAFVTDGNFDSASSLNS |
|---|---|
| Molecular Weight | 61 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Although C1orf25 is similar to N2-dimethylguanosine tRNA methyltransferase from other organisms, the true function of C1orf25 protein is not known. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product