C1QTNF4 Blocking Peptide (33R-8139)
A synthetic peptide for use as a blocking control in assays to test for specificity of C1QTNF4 antibody, catalog no. 70R-5437
Overview
Overview
| Synonyms | C1QTNF4 control peptide, C1QTNF4 antibody Blocking Peptide, Anti-C1QTNF4 Blocking Peptide, C1Q And Tumor Necrosis Factor Related Protein 4 Blocking Peptide, CTRP4 Blocking Peptide, ZACRP4 Blocking Peptide, C1QTNF, CQTNF-1, CQTNF 1, CQTNF-1 Blocking Peptide, CQTNF 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RRGDAVWLLSHDHDGYGAYSNHGKYITFSGFLVYPDLAPAAPPGLGASEL |
|---|---|
| Molecular Weight | 35 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The specific function of C1QTNF4 is not yet known. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product