C1QTNF7 Blocking Peptide (33R-8542)

A synthetic peptide for use as a blocking control in assays to test for specificity of C1QTNF7 antibody, catalog no. 70R-5472

Synonyms C1QTNF7 control peptide, C1QTNF7 antibody Blocking Peptide, Anti-C1QTNF7 Blocking Peptide, C1Q And Tumor Necrosis Factor Related Protein 7 Blocking Peptide, CTRP7 Blocking Peptide, ZACRP7 Blocking Peptide, C1QTNF, CQTNF-1, CQTNF 1, CQTNF-1 Blocking Peptide, CQTNF 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGI
Molecular Weight 31 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of C1QTNF7 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors