C20ORF10 Blocking Peptide (33R-8050)
A synthetic peptide for use as a blocking control in assays to test for specificity of C20orf10 antibody, catalog no. 70R-5857
Overview
Overview
| Synonyms | C20ORF10 control peptide, C20ORF10 antibody Blocking Peptide, Anti-C20ORF10 Blocking Peptide, CLG01 Blocking Peptide, TP53TG5 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RLRTVLKNLSLLKLLKSSNRRIQELHKLAKRCWHSLLSVPKILRISSGEN |
|---|---|
| Molecular Weight | 32 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | C20orf10 may play a significant role in p53/TP53-mediating signaling pathway. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product