C20ORF10 Blocking Peptide (33R-8050)

A synthetic peptide for use as a blocking control in assays to test for specificity of C20orf10 antibody, catalog no. 70R-5857

Synonyms C20ORF10 control peptide, C20ORF10 antibody Blocking Peptide, Anti-C20ORF10 Blocking Peptide, CLG01 Blocking Peptide, TP53TG5 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RLRTVLKNLSLLKLLKSSNRRIQELHKLAKRCWHSLLSVPKILRISSGEN
Molecular Weight 32 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C20orf10 may play a significant role in p53/TP53-mediating signaling pathway.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors