C20ORF18 antibody (70R-1161)

Rabbit polyclonal C20ORF18 antibody raised against the middle region of C20Orf18

Synonyms Polyclonal C20ORF18 antibody, Anti-C20ORF18 antibody, C20orf18 antibody, Chromosome ORF-20, RBCK2 antibody, Chromosome ORF-20 antibody, RP5-852M4.4 antibody, ZRANB4 antibody, Chromosome ORF 20 antibody, Chromosome ORF 20, RNF54 antibody, UBCE7IP3 antibody, Chromosome 20 ORF, XAP4 antibody, HOIL1 antibody
Specificity C20ORF18 antibody was raised against the middle region of C20Orf18
Cross Reactivity Human,Mouse
Applications WB
Immunogen C20ORF18 antibody was raised using the middle region of C20Orf18 corresponding to a region with amino acids AYQVPASYQPDEEERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLDQRS
Assay Information C20ORF18 Blocking Peptide, catalog no. 33R-1633, is also available for use as a blocking control in assays to test for specificity of this C20ORF18 antibody

Images

Western Blot analysis using C20ORF18 antibody (70R-1161)

C20ORF18 antibody (70R-1161) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of C20ORF18 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C20orf18 is similar to mouse UIP28/UbcM4 interacting protein.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C20ORF18 antibody (70R-1161) | C20ORF18 antibody (70R-1161) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors