C20ORF19 Blocking Peptide (33R-8753)

A synthetic peptide for use as a blocking control in assays to test for specificity of C20orf19 antibody, catalog no. 70R-4436

Synonyms C20ORF19 control peptide, C20ORF19 antibody Blocking Peptide, Anti-C20ORF19 Blocking Peptide, DKFZP586H021 Blocking Peptide, HT013 Blocking Peptide, MGC102941 Blocking Peptide, MGC141930 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SRHENKKKPVINLKSNALWDESDDSNSEIEAALRPRNHNTDDSDDFYD
Molecular Weight 75 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C20orf19 encodes a centrosomal protein required for establishing a robust mitotic centrosome architecture that can endure theforces that converge on the centrosomes during spindle formation. Required for stabilizing the expanded pericentriolar material around the centriole.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors