C20ORF19 Blocking Peptide (33R-8753)
A synthetic peptide for use as a blocking control in assays to test for specificity of C20orf19 antibody, catalog no. 70R-4436
Overview
Overview
| Synonyms | C20ORF19 control peptide, C20ORF19 antibody Blocking Peptide, Anti-C20ORF19 Blocking Peptide, DKFZP586H021 Blocking Peptide, HT013 Blocking Peptide, MGC102941 Blocking Peptide, MGC141930 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SRHENKKKPVINLKSNALWDESDDSNSEIEAALRPRNHNTDDSDDFYD |
|---|---|
| Molecular Weight | 75 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | C20orf19 encodes a centrosomal protein required for establishing a robust mitotic centrosome architecture that can endure theforces that converge on the centrosomes during spindle formation. Required for stabilizing the expanded pericentriolar material around the centriole. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product