C20ORF3 Blocking Peptide (33R-7541)
A synthetic peptide for use as a blocking control in assays to test for specificity of C20orf3 antibody, catalog no. 70R-1818
Overview
Overview
| Synonyms | C20ORF3 control peptide, C20ORF3 antibody Blocking Peptide, Anti-C20ORF3 Blocking Peptide, APMAP Blocking Peptide, BSCv Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYL |
|---|---|
| Molecular Weight | 46 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | C20orf3 may play a role in adipocyte differentiation. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product