C21ORF13 antibody (70R-3197)

Rabbit polyclonal C21ORF13 antibody raised against the N terminal Of C21Orf13

Synonyms Polyclonal C21ORF13 antibody, Anti-C21ORF13 antibody, MGC33295 antibody, Chromosome ORF 21 antibody, Chromosome ORF-21 antibody, Chromosome ORF 21, Chromosome 21 ORF, Chromosome ORF-21
Specificity C21ORF13 antibody was raised against the N terminal Of C21Orf13
Cross Reactivity Human
Applications WB
Immunogen C21ORF13 antibody was raised using the N terminal Of C21Orf13 corresponding to a region with amino acids SLADLTKTNIDEHFFGVALENNRRSAACKRSPGTGDFSRNSNASNKSVDY
Assay Information C21ORF13 Blocking Peptide, catalog no. 33R-8574, is also available for use as a blocking control in assays to test for specificity of this C21ORF13 antibody


Western Blot analysis using C21ORF13 antibody (70R-3197)

C21ORF13 antibody (70R-3197) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 76 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C21ORF13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of the C21orf13 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C21ORF13 antibody (70R-3197) | C21ORF13 antibody (70R-3197) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors