C21ORF56 antibody (70R-1971)

Rabbit polyclonal C21ORF56 antibody

Synonyms Polyclonal C21ORF56 antibody, Anti-C21ORF56 antibody, Chromosome ORF 21 antibody, Chromosome 21 ORF, Chromosome ORF-21, DKFZp434N0650 antibody, Chromosome ORF-21 antibody, MGC99490 antibody, Chromosome ORF 21
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C21ORF56 antibody was raised using a synthetic peptide corresponding to a region with amino acids EKLGYSRDVHPAFSEFLINTYGILKQRPDLRANPLHSSPAALRKLVIDVV
Assay Information C21ORF56 Blocking Peptide, catalog no. 33R-2511, is also available for use as a blocking control in assays to test for specificity of this C21ORF56 antibody


Western Blot analysis using C21ORF56 antibody (70R-1971)

C21ORF56 antibody (70R-1971) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C21ORF56 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C21orf56 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C21ORF56 antibody (70R-1971) | C21ORF56 antibody (70R-1971) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors