C22ORF28 antibody (70R-4339)

Rabbit polyclonal C22ORF28 antibody raised against the middle region of C22Orf28

Synonyms Polyclonal C22ORF28 antibody, Anti-C22ORF28 antibody, Chromosome ORF 22, RP1-149A16.6 antibody, Chromosome ORF 22 antibody, Chromosome ORF-22 antibody, HSPC117 antibody, DJ149A16.6 antibody, Chromosome 22 ORF, Chromosome ORF-22
Specificity C22ORF28 antibody was raised against the middle region of C22Orf28
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen C22ORF28 antibody was raised using the middle region of C22Orf28 corresponding to a region with amino acids EQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTC
Assay Information C22ORF28 Blocking Peptide, catalog no. 33R-2666, is also available for use as a blocking control in assays to test for specificity of this C22ORF28 antibody

Images

Western Blot analysis using C22ORF28 antibody (70R-4339)

C22ORF28 antibody (70R-4339) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C22ORF28 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C22ORF28 is believed to be involved in vinculin binding.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C22ORF28 antibody (70R-4339) | C22ORF28 antibody (70R-4339) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors