C22ORF9 antibody (70R-3145)

Rabbit polyclonal C22ORF9 antibody raised against the middle region of C22Orf9

Synonyms Polyclonal C22ORF9 antibody, Anti-C22ORF9 antibody, Chromosome ORF 22 antibody, Chromosome ORF-22 antibody, , Chromosome 22 ORF, Chromosome ORF-22, Chromosome ORF 22
Specificity C22ORF9 antibody was raised against the middle region of C22Orf9
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C22ORF9 antibody was raised using the middle region of C22Orf9 corresponding to a region with amino acids ERVTSFSTPPTPERNNRPAFFSPSLKRKVPRNRIAEMKKSHSANDSEEFF
Assay Information C22ORF9 Blocking Peptide, catalog no. 33R-2717, is also available for use as a blocking control in assays to test for specificity of this C22ORF9 antibody

Images

Western Blot analysis using C22ORF9 antibody (70R-3145)

C22ORF9 antibody (70R-3145) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C22ORF9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C22orf9 has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C22ORF9 antibody (70R-3145) | C22ORF9 antibody (70R-3145) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors