C2ORF25 Blocking Peptide (33R-7803)
A synthetic peptide for use as a blocking control in assays to test for specificity of C2orf25 antibody, catalog no. 70R-2461
Overview
Overview
| Synonyms | C2ORF25 control peptide, C2ORF25 antibody Blocking Peptide, Anti-C2ORF25 Blocking Peptide, CL25022 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RAEGYWADFIDPSSGLAFFGPYTNNTLFETDERYRHLGFSVDDLGCCKVI |
|---|---|
| Molecular Weight | 33 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Vitamin B12 (cobalamin) is an essential cofactor in several metabolic pathways. Intracellular conversion of cobalamin to adenosylcobalamin in mitochondria and to methylcobalamin in cytoplasm is necessary for homeostasis of methylmalonic acid and homocysteine. C2ORF25 encodes a protein involved in an early step of cobalamin metabolism. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product